SCOPe 2.03: Domain d4guhb1: 4guh B:0-252

Lineage for d4guhb1 (4guh B:0-252)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (17 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries)

8. Domain d4guhb1: 4guh B:0-252 [222175]
   automated match to d3oexb_
   complexed with 3ds, ni; mutant

Details for d4guhb1

PDB Entry: 4guh, 1.95 Å

PDB Description: 1.95 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4guhb1:

Sequence; same for both SEQRES and ATOM records:

>d4guhb1 c.1.10.1 (B:0-252) automated matches {Salmonella typhimurium [TaxId: 90371]}
amktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttae
svleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelft
gddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtka
dvltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisv
adlrtvltilhqa

Timeline for d4guhb1:

• d4guhb1 is new in SCOPe 2.03-stable
  
• d4guhb1 appears in SCOPe 2.04
  
• d4guhb1 appears in the current release, SCOPe 2.08