Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (17 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries) |
Domain d4guhb1: 4guh B:0-252 [222175] automated match to d3oexb_ complexed with 3ds, ni; mutant |
PDB Entry: 4guh (more details), 1.95 Å
SCOPe Domain Sequences for d4guhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4guhb1 c.1.10.1 (B:0-252) automated matches {Salmonella typhimurium [TaxId: 90371]} amktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttae svleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelft gddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtka dvltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisv adlrtvltilhqa
Timeline for d4guhb1: