Lineage for d4guha1 (4guh A:1-251)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2420460Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2421010Protein automated matches [190095] (23 species)
    not a true protein
  7. 2421236Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries)
  8. 2421246Domain d4guha1: 4guh A:1-251 [222174]
    Other proteins in same PDB: d4guha2, d4guhb2
    automated match to d3oexb_
    complexed with 3ds, ni; mutant

Details for d4guha1

PDB Entry: 4guh (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4guha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guha1 c.1.10.1 (A:1-251) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhq

SCOPe Domain Coordinates for d4guha1:

Click to download the PDB-style file with coordinates for d4guha1.
(The format of our PDB-style files is described here.)

Timeline for d4guha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4guha2