Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries) |
Domain d4gufb1: 4guf B:1-252 [222171] Other proteins in same PDB: d4gufa2, d4gufb2 automated match to d3oexb_ complexed with cl; mutant |
PDB Entry: 4guf (more details), 1.5 Å
SCOPe Domain Sequences for d4gufb1:
Sequence, based on SEQRES records: (download)
>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva dlrtvltilhqa
>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkqisvadlrtvl tilhqa
Timeline for d4gufb1: