SCOPe 2.07: Domain d4gufb1: 4guf B:1-252

Lineage for d4gufb1 (4guf B:1-252)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries)

8. Domain d4gufb1: 4guf B:1-252 [222171]
   Other proteins in same PDB: d4gufa2, d4gufb2
   automated match to d3oexb_
   complexed with cl; mutant

Details for d4gufb1

PDB Entry: 4guf, 1.5 Å

PDB Description: 1.5 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) e86a mutant

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4gufb1:

Sequence, based on SEQRES records:

>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhqa

Sequence, based on observed residues (ATOM records):

>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkqisvadlrtvl
tilhqa

Timeline for d4gufb1:

• d4gufb1 first appeared in SCOPe 2.03, called d4gufb_
  
• d4gufb1 appears in SCOPe 2.06
  
• d4gufb1 appears in the current release, SCOPe 2.08