Lineage for d4gufb1 (4guf B:1-252)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085665Protein automated matches [190095] (24 species)
    not a true protein
  7. 2085876Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries)
  8. 2085878Domain d4gufb1: 4guf B:1-252 [222171]
    Other proteins in same PDB: d4gufa2, d4gufb2
    automated match to d3oexb_
    complexed with cl; mutant

Details for d4gufb1

PDB Entry: 4guf (more details), 1.5 Å

PDB Description: 1.5 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) e86a mutant
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4gufb1:

Sequence, based on SEQRES records: (download)

>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhqa

Sequence, based on observed residues (ATOM records): (download)

>d4gufb1 c.1.10.1 (B:1-252) automated matches {Salmonella typhimurium [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakaggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkqisvadlrtvl
tilhqa

SCOPe Domain Coordinates for d4gufb1:

Click to download the PDB-style file with coordinates for d4gufb1.
(The format of our PDB-style files is described here.)

Timeline for d4gufb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gufb2