SCOPe 2.08: Domain d4gudb1: 4gud B:2-203

Lineage for d4gudb1 (4gud B:2-203)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189482] (2 PDB entries)

8. Domain d4gudb1: 4gud B:2-203 [222168]
   Other proteins in same PDB: d4guda2, d4gudb2
   automated match to d1kxjb_
   complexed with 1pe, edo, gol, peg

Details for d4gudb1

PDB Entry: 4gud, 1.91 Å

PDB Description: crystal structure of amidotransferase hish from vibrio cholerae

PDB Compounds: (B:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d4gudb1:

Sequence, based on SEQRES records:

>d4gudb1 c.23.16.0 (B:2-203) automated matches {Vibrio cholerae [TaxId: 243277]}
tqnvviidtgcanissvkfaierlgyavtisrdpqvvlaadklflpgvgtaseamknlte
rdlielvkrvekpllgiclgmqllgklseekgqkadeivqclglvdgevrllqtgdlplp
hmgwntvqvkeghplfngiepdayfyfvhsfampvgdytiaqceygqpfsaaiqagnyyg
vqfhpersskagarliqnflel

Sequence, based on observed residues (ATOM records):

>d4gudb1 c.23.16.0 (B:2-203) automated matches {Vibrio cholerae [TaxId: 243277]}
tqnvviidtgcanissvkfaierlgyavtisrdpqvvlaadklflpgvgtaseamknlte
rdlielvkrvekpllgiclgmqllgklseekeivqclglvdgevrllqtgdlplphmgwn
tvqvkeghplfngiepdayfyfvhsfampvgdytiaqceygqpfsaaiqagnyygvqfhp
ersskagarliqnflel

Timeline for d4gudb1:

• d4gudb1 first appeared in SCOPe 2.03, called d4gudb_
  
• d4gudb1 appears in SCOPe 2.07