Lineage for d4gudb1 (4gud B:2-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859508Species Vibrio cholerae [TaxId:243277] [189482] (2 PDB entries)
  8. 2859512Domain d4gudb1: 4gud B:2-203 [222168]
    Other proteins in same PDB: d4guda2, d4gudb2
    automated match to d1kxjb_
    complexed with 1pe, edo, gol, peg

Details for d4gudb1

PDB Entry: 4gud (more details), 1.91 Å

PDB Description: crystal structure of amidotransferase hish from vibrio cholerae
PDB Compounds: (B:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d4gudb1:

Sequence, based on SEQRES records: (download)

>d4gudb1 c.23.16.0 (B:2-203) automated matches {Vibrio cholerae [TaxId: 243277]}
tqnvviidtgcanissvkfaierlgyavtisrdpqvvlaadklflpgvgtaseamknlte
rdlielvkrvekpllgiclgmqllgklseekgqkadeivqclglvdgevrllqtgdlplp
hmgwntvqvkeghplfngiepdayfyfvhsfampvgdytiaqceygqpfsaaiqagnyyg
vqfhpersskagarliqnflel

Sequence, based on observed residues (ATOM records): (download)

>d4gudb1 c.23.16.0 (B:2-203) automated matches {Vibrio cholerae [TaxId: 243277]}
tqnvviidtgcanissvkfaierlgyavtisrdpqvvlaadklflpgvgtaseamknlte
rdlielvkrvekpllgiclgmqllgklseekeivqclglvdgevrllqtgdlplphmgwn
tvqvkeghplfngiepdayfyfvhsfampvgdytiaqceygqpfsaaiqagnyygvqfhp
ersskagarliqnflel

SCOPe Domain Coordinates for d4gudb1:

Click to download the PDB-style file with coordinates for d4gudb1.
(The format of our PDB-style files is described here.)

Timeline for d4gudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gudb2