Lineage for d4gu2a_ (4gu2 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402659Protein automated matches [190118] (8 species)
    not a true protein
  7. 1402671Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [193323] (2 PDB entries)
  8. 1402672Domain d4gu2a_: 4gu2 A: [222166]
    automated match to d4gswa_

Details for d4gu2a_

PDB Entry: 4gu2 (more details), 1.35 Å

PDB Description: Crystal structure of ubiquitin from Entamoeba histolytica to 1.35 Angstrom
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d4gu2a_:

Sequence, based on SEQRES records: (download)

>d4gu2a_ d.15.1.1 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyn
iqkestlhlvlr

Sequence, based on observed residues (ATOM records): (download)

>d4gu2a_ d.15.1.1 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mqifvkktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyniqke
stlhlvlr

SCOPe Domain Coordinates for d4gu2a_:

Click to download the PDB-style file with coordinates for d4gu2a_.
(The format of our PDB-style files is described here.)

Timeline for d4gu2a_: