SCOPe 2.06: Domain d4gtob_: 4gto B:

Lineage for d4gtob_ (4gto B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d4gtob_: 4gto B: [222159]
   Other proteins in same PDB: d4gtoa_
   automated match to d4gtpb_
   complexed with 7to, dms, fpp, zn

Details for d4gtob_

PDB Entry: 4gto, 2.15 Å

PDB Description: FTase in complex with BMS analogue 14

PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d4gtob_:

Sequence; same for both SEQRES and ATOM records:

>d4gtob_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrek
hfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspd
ggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvgg
evdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgla
alvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralha
qgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfg
sgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d4gtob_:

• d4gtob_ first appeared in SCOPe 2.03
  
• d4gtob_ appears in SCOPe 2.05
  
• d4gtob_ appears in SCOPe 2.07
  
• d4gtob_ appears in the current release, SCOPe 2.08