Lineage for d1e9pa_ (1e9p A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. Domain d1e9pa_: 1e9p A: [22215]
    complexed with cu, zn

Details for d1e9pa_

PDB Entry: 1e9p (more details), 1.7 Å

PDB Description: Crystal structure of bovine Cu, Zn SOD to 1.7 Angstrom (3 of 3)
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1e9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9pa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atsavcvlsgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpsdeerhvgdlgnvtadsngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigias

SCOPe Domain Coordinates for d1e9pa_ are not available.

Timeline for d1e9pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e9pb_