SCOPe 2.05: Domain d4gt7c1: 4gt7 C:332-438

Lineage for d4gt7c1 (4gt7 C:332-438)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d4gt7c1: 4gt7 C:332-438 [222143]
automated match to d1f6ab1

Details for d4gt7c1

PDB Entry: 4gt7 (more details), 2.61 Å

PDB Description: an engineered disulfide bond reversibly traps the ige-fc3-4 in a closed, non-receptor binding conformation

PDB Compounds: (C:) ig epsilon chain c region

SCOPe Domain Sequences for d4gt7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gt7c1 b.1.1.2 (C:332-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeek
qrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOPe Domain Coordinates for d4gt7c1:

Click to download the PDB-style file with coordinates for d4gt7c1.
(The format of our PDB-style files is described here.)

Timeline for d4gt7c1: