Lineage for d4gt7a2 (4gt7 A:439-545)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029661Domain d4gt7a2: 4gt7 A:439-545 [222140]
    automated match to d1f6ab2

Details for d4gt7a2

PDB Entry: 4gt7 (more details), 2.61 Å

PDB Description: an engineered disulfide bond reversibly traps the ige-fc3-4 in a closed, non-receptor binding conformation
PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d4gt7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gt7a2 b.1.1.2 (A:439-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOPe Domain Coordinates for d4gt7a2:

Click to download the PDB-style file with coordinates for d4gt7a2.
(The format of our PDB-style files is described here.)

Timeline for d4gt7a2: