Lineage for d1cbjb_ (1cbj B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037424Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2037425Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2037438Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2037479Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 2037487Domain d1cbjb_: 1cbj B: [22214]
    complexed with cu, zn

Details for d1cbjb_

PDB Entry: 1cbj (more details), 1.65 Å

PDB Description: crystal structure of bovine superoxide dismutase crystal.
PDB Compounds: (B:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1cbjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbjb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOPe Domain Coordinates for d1cbjb_:

Click to download the PDB-style file with coordinates for d1cbjb_.
(The format of our PDB-style files is described here.)

Timeline for d1cbjb_: