Lineage for d4gt0b2 (4gt0 B:298-404)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376070Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries)
  8. 2376074Domain d4gt0b2: 4gt0 B:298-404 [222134]
    Other proteins in same PDB: d4gt0a1, d4gt0b1
    automated match to d1urza1
    complexed with cd, cl, nag

Details for d4gt0b2

PDB Entry: 4gt0 (more details), 2.57 Å

PDB Description: structure of dengue virus serotype 1 se containing stem to residue 421
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d4gt0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gt0b2 b.1.18.0 (B:298-404) automated matches {Dengue virus 1 [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfea

SCOPe Domain Coordinates for d4gt0b2:

Click to download the PDB-style file with coordinates for d4gt0b2.
(The format of our PDB-style files is described here.)

Timeline for d4gt0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gt0b1