| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries) |
| Domain d4gt0b2: 4gt0 B:298-404 [222134] Other proteins in same PDB: d4gt0a1, d4gt0b1 automated match to d1urza1 complexed with cd, cl, nag |
PDB Entry: 4gt0 (more details), 2.57 Å
SCOPe Domain Sequences for d4gt0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gt0b2 b.1.18.0 (B:298-404) automated matches {Dengue virus 1 [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfea
Timeline for d4gt0b2: