SCOPe 2.03: Domain d4gsya_: 4gsy A:

Lineage for d4gsya_ (4gsy A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)

8. Domain d4gsya_: 4gsy A: [222127]
   automated match to d2ccka_
   complexed with 0y5

Details for d4gsya_

PDB Entry: 4gsy, 1.71 Å

PDB Description: Crystal structure of thymidylate kinase from Staphylococcus aureus bound to inhibitor.

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4gsya_:

Sequence, based on SEQRES records:

>d4gsya_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records):

>d4gsya_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriidqedlkfhekviegyqeiihqrfksvnadqplenvved
tyqtiikylek

Timeline for d4gsya_:

• d4gsya_ is new in SCOPe 2.03-stable
  
• d4gsya_ appears in SCOPe 2.04
  
• d4gsya_ appears in the current release, SCOPe 2.08