Lineage for d4gsya_ (4gsy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872882Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)
  8. 2872883Domain d4gsya_: 4gsy A: [222127]
    automated match to d2ccka_
    complexed with 0y5

Details for d4gsya_

PDB Entry: 4gsy (more details), 1.71 Å

PDB Description: Crystal structure of thymidylate kinase from Staphylococcus aureus bound to inhibitor.
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4gsya_:

Sequence, based on SEQRES records: (download)

>d4gsya_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records): (download)

>d4gsya_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriidqedlkfhekviegyqeiihqrfksvnadqplenvved
tyqtiikylek

SCOPe Domain Coordinates for d4gsya_:

Click to download the PDB-style file with coordinates for d4gsya_.
(The format of our PDB-style files is described here.)

Timeline for d4gsya_: