SCOPe 2.03: Domain d4gsxb2: 4gsx B:298-404

Lineage for d4gsxb2 (4gsx B:298-404)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (22 species)
   not a true protein

7. Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries)

8. Domain d4gsxb2: 4gsx B:298-404 [222126]
   Other proteins in same PDB: d4gsxa1, d4gsxb1
   automated match to d1urza1
   complexed with cd, cl, nag

Details for d4gsxb2

PDB Entry: 4gsx, 1.9 Å

PDB Description: high resolution structure of dengue virus serotype 1 se containing stem

PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d4gsxb2:

Sequence; same for both SEQRES and ATOM records:

>d4gsxb2 b.1.18.0 (B:298-404) automated matches {Dengue virus 1 [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfea

Timeline for d4gsxb2:

• d4gsxb2 is new in SCOPe 2.03-stable
  
• d4gsxb2 appears in SCOPe 2.04
  
• d4gsxb2 appears in the current release, SCOPe 2.08