Lineage for d4gsxb1 (4gsx B:2-297)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (7 species)
    not a true protein
  7. 2576634Species Dengue virus 1 [TaxId:11059] [226543] (2 PDB entries)
  8. 2576636Domain d4gsxb1: 4gsx B:2-297 [222125]
    Other proteins in same PDB: d4gsxa2, d4gsxb2
    automated match to d1urza2
    complexed with cd, cl, nag

Details for d4gsxb1

PDB Entry: 4gsx (more details), 1.9 Å

PDB Description: high resolution structure of dengue virus serotype 1 se containing stem
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d4gsxb1:

Sequence, based on SEQRES records: (download)

>d4gsxb1 f.10.1.0 (B:2-297) automated matches {Dengue virus 1 [TaxId: 11059]}
rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc
vtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiatitpqaptseiqltdygal
tldcsprtgldfnemvlltmekkswlvhkqwfldlplpwtsgastsqetwnrqdllvtfk
tahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm

Sequence, based on observed residues (ATOM records): (download)

>d4gsxb1 f.10.1.0 (B:2-297) automated matches {Dengue virus 1 [TaxId: 11059]}
rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrggngcglfgkgslitcakfkcv
tklegkivqyenlkysvivtvhthgtiatitpqaptseiqltdygaltldcsprtgldfn
emvlltmekkswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvlg
sqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm

SCOPe Domain Coordinates for d4gsxb1:

Click to download the PDB-style file with coordinates for d4gsxb1.
(The format of our PDB-style files is described here.)

Timeline for d4gsxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gsxb2