Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries) |
Domain d4gsxa2: 4gsx A:298-403 [222124] Other proteins in same PDB: d4gsxa1, d4gsxb1 automated match to d1urza1 complexed with cd, cl, nag |
PDB Entry: 4gsx (more details), 1.9 Å
SCOPe Domain Sequences for d4gsxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gsxa2 b.1.18.0 (A:298-403) automated matches {Dengue virus 1 [TaxId: 11059]} syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfe
Timeline for d4gsxa2: