Lineage for d4gsxa2 (4gsx A:298-403)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771114Species Dengue virus 1 [TaxId:11059] [226544] (2 PDB entries)
  8. 1771115Domain d4gsxa2: 4gsx A:298-403 [222124]
    Other proteins in same PDB: d4gsxa1, d4gsxb1
    automated match to d1urza1
    complexed with cd, cl, nag

Details for d4gsxa2

PDB Entry: 4gsx (more details), 1.9 Å

PDB Description: high resolution structure of dengue virus serotype 1 se containing stem
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d4gsxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gsxa2 b.1.18.0 (A:298-403) automated matches {Dengue virus 1 [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfe

SCOPe Domain Coordinates for d4gsxa2:

Click to download the PDB-style file with coordinates for d4gsxa2.
(The format of our PDB-style files is described here.)

Timeline for d4gsxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gsxa1