![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (3 species) not a true protein |
![]() | Species Dengue virus 1 [TaxId:11059] [226543] (2 PDB entries) |
![]() | Domain d4gsxa1: 4gsx A:2-297 [222123] Other proteins in same PDB: d4gsxa2, d4gsxb2 automated match to d1urza2 complexed with cd, cl, nag |
PDB Entry: 4gsx (more details), 1.9 Å
SCOPe Domain Sequences for d4gsxa1:
Sequence, based on SEQRES records: (download)
>d4gsxa1 f.10.1.0 (A:2-297) automated matches {Dengue virus 1 [TaxId: 11059]} rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc vtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiatitpqaptseiqltdygal tldcsprtgldfnemvlltmekkswlvhkqwfldlplpwtsgastsqetwnrqdllvtfk tahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm
>d4gsxa1 f.10.1.0 (A:2-297) automated matches {Dengue virus 1 [TaxId: 11059]} rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc vtklegkivqyenlkysvivtvhtggtiatitpqaptseiqltdygaltldcsprtgldf nemvlltmekkswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvl gsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm
Timeline for d4gsxa1: