Lineage for d4gsvb_ (4gsv B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453552Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2453553Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2453554Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2453798Protein automated matches [190112] (3 species)
    not a true protein
  7. 2453799Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)
  8. 2453803Domain d4gsvb_: 4gsv B: [222122]
    automated match to d2zava_
    complexed with abh, ni

Details for d4gsvb_

PDB Entry: 4gsv (more details), 1.48 Å

PDB Description: Crystal Structure of the Ni2+2-Human Arginase I-ABH complex
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d4gsvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gsvb_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

SCOPe Domain Coordinates for d4gsvb_:

Click to download the PDB-style file with coordinates for d4gsvb_.
(The format of our PDB-style files is described here.)

Timeline for d4gsvb_: