SCOPe 2.06: Domain d1akpa_: 1akp A:

Lineage for d1akpa_ (1akp A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein Kedarcidin [49327] (1 species)

7. Species Actinomycete ATCC 53650, strain L585-6 [TaxId:38989] [49328] (1 PDB entry)

8. Domain d1akpa_: 1akp A: [22212]

Details for d1akpa_

PDB Entry: 1akp

PDB Description: sequential 1h,13c and 15n nmr assignments and solution conformation of apokedarcidin

PDB Compounds: (A:) apokedarcidin

SCOPe Domain Sequences for d1akpa_:

Sequence; same for both SEQRES and ATOM records:

>d1akpa_ b.1.7.1 (A:) Kedarcidin {Actinomycete ATCC 53650, strain L585-6 [TaxId: 38989]}
asaavsvspatgladgatvtvsasgfatstsatalqcailadgrgacnvaefhdfslsgg
egttsvvvrrsftgyvmpdgpevgavdcdtapggceivvggntgeygnaaisfg

Timeline for d1akpa_:

• d1akpa_ first appeared (with stable ids) in SCOP 1.55, called d1akp__
  
• d1akpa_ appears in SCOPe 2.05
  
• d1akpa_ appears in SCOPe 2.07
  
• d1akpa_ appears in the current release, SCOPe 2.08