Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) automatically mapped to Pfam PF00960 |
Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
Protein Kedarcidin [49327] (1 species) |
Species Actinomycete ATCC 53650, strain L585-6 [TaxId:38989] [49328] (1 PDB entry) |
Domain d1akpa_: 1akp A: [22212] |
PDB Entry: 1akp (more details)
SCOPe Domain Sequences for d1akpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akpa_ b.1.7.1 (A:) Kedarcidin {Actinomycete ATCC 53650, strain L585-6 [TaxId: 38989]} asaavsvspatgladgatvtvsasgfatstsatalqcailadgrgacnvaefhdfslsgg egttsvvvrrsftgyvmpdgpevgavdcdtapggceivvggntgeygnaaisfg
Timeline for d1akpa_: