Lineage for d1akpa_ (1akp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763669Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) (S)
    automatically mapped to Pfam PF00960
  5. 2763670Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)
  6. 2763680Protein Kedarcidin [49327] (1 species)
  7. 2763681Species Actinomycete ATCC 53650, strain L585-6 [TaxId:38989] [49328] (1 PDB entry)
  8. 2763682Domain d1akpa_: 1akp A: [22212]

Details for d1akpa_

PDB Entry: 1akp (more details)

PDB Description: sequential 1h,13c and 15n nmr assignments and solution conformation of apokedarcidin
PDB Compounds: (A:) apokedarcidin

SCOPe Domain Sequences for d1akpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akpa_ b.1.7.1 (A:) Kedarcidin {Actinomycete ATCC 53650, strain L585-6 [TaxId: 38989]}
asaavsvspatgladgatvtvsasgfatstsatalqcailadgrgacnvaefhdfslsgg
egttsvvvrrsftgyvmpdgpevgavdcdtapggceivvggntgeygnaaisfg

SCOPe Domain Coordinates for d1akpa_:

Click to download the PDB-style file with coordinates for d1akpa_.
(The format of our PDB-style files is described here.)

Timeline for d1akpa_: