SCOPe 2.08: Domain d4gs9a1: 4gs9 A:239-348

Lineage for d4gs9a1 (4gs9 A:239-348)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)

8. Domain d4gs9a1: 4gs9 A:239-348 [222117]
   Other proteins in same PDB: d4gs9a2, d4gs9b_
   automated match to d3f1na_
   complexed with 0xb, pe8

Details for d4gs9a1

PDB Entry: 4gs9, 1.72 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist

PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d4gs9a1:

Sequence, based on SEQRES records:

>d4gs9a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie

Sequence, based on observed residues (ATOM records):

>d4gs9a1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseie

Timeline for d4gs9a1:

• d4gs9a1 first appeared in SCOPe 2.03, called d4gs9a_
  
• d4gs9a1 appears in SCOPe 2.07