Lineage for d4grxd_ (4grx D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132784Species Paracoccus denitrificans [TaxId:318586] [224906] (1 PDB entry)
  8. 2132788Domain d4grxd_: 4grx D: [222115]
    automated match to d3gjua_
    complexed with dav, na

Details for d4grxd_

PDB Entry: 4grx (more details), 2.6 Å

PDB Description: structure of an omega-aminotransferase from paracoccus denitrificans
PDB Compounds: (D:) aminotransferase

SCOPe Domain Sequences for d4grxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grxd_ c.67.1.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfd
hkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdngrvfytnsgseandtm
vkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfihltcphy
wrygeegeteaqfvarlareledtitregadtiagffaepvmgaggvippakgyfqailp
ilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknltagffpmgavilgpdla
krveaaveaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeaglkria
drpnigeyrgigfmwaleavkdkptktpfdanlsvseriantctdlglicrplgqsivlc
ppfilteaqmdemfeklekaldkvfaeva

SCOPe Domain Coordinates for d4grxd_:

Click to download the PDB-style file with coordinates for d4grxd_.
(The format of our PDB-style files is described here.)

Timeline for d4grxd_: