Lineage for d4grmd1 (4grm D:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756102Domain d4grmd1: 4grm D:1-117 [222110]
    Other proteins in same PDB: d4grma1, d4grma2, d4grmb2, d4grmc1, d4grmc2, d4grmd2
    automated match to d1ktke1

Details for d4grmd1

PDB Entry: 4grm (more details), 2 Å

PDB Description: the crystal structure of the high affinity tcr a6
PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d4grmd1:

Sequence, based on SEQRES records: (download)

>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpgmsaqpeqyfgpgtrltvte

SCOPe Domain Coordinates for d4grmd1:

Click to download the PDB-style file with coordinates for d4grmd1.
(The format of our PDB-style files is described here.)

Timeline for d4grmd1: