SCOPe 2.08: Domain d4grmc1: 4grm C:1-117

Lineage for d4grmc1 (4grm C:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4grmc1: 4grm C:1-117 [222108]
   Other proteins in same PDB: d4grma2, d4grmb1, d4grmb2, d4grmc2, d4grmd1, d4grmd2
   automated match to d1qrnd1

Details for d4grmc1

PDB Entry: 4grm, 2 Å

PDB Description: the crystal structure of the high affinity tcr a6

PDB Compounds: (C:) A6 alpha chain

SCOPe Domain Sequences for d4grmc1:

Sequence; same for both SEQRES and ATOM records:

>d4grmc1 b.1.1.1 (C:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

Timeline for d4grmc1:

• d4grmc1 first appeared in SCOPe 2.03
  
• d4grmc1 appears in SCOPe 2.07