Lineage for d4grmb1 (4grm B:3-117)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355747Domain d4grmb1: 4grm B:3-117 [222106]
    Other proteins in same PDB: d4grma1, d4grma2, d4grmb2, d4grmc1, d4grmc2, d4grmd2
    automated match to d1ktke1

Details for d4grmb1

PDB Entry: 4grm (more details), 2 Å

PDB Description: the crystal structure of the high affinity tcr a6
PDB Compounds: (B:) A6 beta chain

SCOPe Domain Sequences for d4grmb1:

Sequence, based on SEQRES records: (download)

>d4grmb1 b.1.1.0 (B:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d4grmb1 b.1.1.0 (B:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglqpeqyfgpgtrltvte

SCOPe Domain Coordinates for d4grmb1:

Click to download the PDB-style file with coordinates for d4grmb1.
(The format of our PDB-style files is described here.)

Timeline for d4grmb1: