Lineage for d4grma1 (4grm A:2-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742708Domain d4grma1: 4grm A:2-117 [222104]
    Other proteins in same PDB: d4grma2, d4grmb1, d4grmb2, d4grmc2, d4grmd1, d4grmd2
    automated match to d1qrnd1

Details for d4grma1

PDB Entry: 4grm (more details), 2 Å

PDB Description: the crystal structure of the high affinity tcr a6
PDB Compounds: (A:) A6 alpha chain

SCOPe Domain Sequences for d4grma1:

Sequence, based on SEQRES records: (download)

>d4grma1 b.1.1.1 (A:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrft
aqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

Sequence, based on observed residues (ATOM records): (download)

>d4grma1 b.1.1.1 (A:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrft
aqlnkasqyvsllirdsqpsdsatylcavttgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d4grma1:

Click to download the PDB-style file with coordinates for d4grma1.
(The format of our PDB-style files is described here.)

Timeline for d4grma1: