SCOPe 2.06: Domain d1ncob_: 1nco B:

Lineage for d1ncob_ (1nco B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein Neocarzinostatin [49323] (1 species)

7. Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries)

8. Domain d1ncob_: 1nco B: [22210]
   complexed with chr, mrd

Details for d1ncob_

PDB Entry: 1nco, 1.8 Å

PDB Description: structure of the antitumor protein-chromophore complex neocarzinostatin

PDB Compounds: (B:) holo-neocarzinostatin

SCOPe Domain Sequences for d1ncob_:

Sequence; same for both SEQRES and ATOM records:

>d1ncob_ b.1.7.1 (B:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn

Timeline for d1ncob_:

• d1ncob_ first appeared (with stable ids) in SCOP 1.55
  
• d1ncob_ appears in SCOPe 2.05
  
• d1ncob_ appears in SCOPe 2.07
  
• d1ncob_ appears in the current release, SCOPe 2.08