Lineage for d1ncob_ (1nco B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763669Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) (S)
    automatically mapped to Pfam PF00960
  5. 2763670Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)
  6. 2763686Protein Neocarzinostatin [49323] (1 species)
  7. 2763687Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries)
  8. 2763689Domain d1ncob_: 1nco B: [22210]
    complexed with chr, mrd

Details for d1ncob_

PDB Entry: 1nco (more details), 1.8 Å

PDB Description: structure of the antitumor protein-chromophore complex neocarzinostatin
PDB Compounds: (B:) holo-neocarzinostatin

SCOPe Domain Sequences for d1ncob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncob_ b.1.7.1 (B:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn

SCOPe Domain Coordinates for d1ncob_:

Click to download the PDB-style file with coordinates for d1ncob_.
(The format of our PDB-style files is described here.)

Timeline for d1ncob_: