Lineage for d4grba_ (4grb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982560Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2982561Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries)
  8. 2982741Domain d4grba_: 4grb A: [222099]
    automated match to d3ngaa_
    complexed with 0xg, cl

Details for d4grba_

PDB Entry: 4grb (more details), 2.15 Å

PDB Description: Casein kinase 2 (CK2) bound to inhibitor
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d4grba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grba_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvv

SCOPe Domain Coordinates for d4grba_:

Click to download the PDB-style file with coordinates for d4grba_.
(The format of our PDB-style files is described here.)

Timeline for d4grba_: