SCOPe 2.08: Domain d1noaa_: 1noa A:

Lineage for d1noaa_ (1noa A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein Neocarzinostatin [49323] (1 species)

7. Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries)

8. Domain d1noaa_: 1noa A: [22208]

Details for d1noaa_

PDB Entry: 1noa, 1.5 Å

PDB Description: crystal structure of apo-neocarzinostatin at 0.15 nm resolution

PDB Compounds: (A:) neocarzinostatin

SCOPe Domain Sequences for d1noaa_:

Sequence; same for both SEQRES and ATOM records:

>d1noaa_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn

Timeline for d1noaa_:

• d1noaa_ first appeared (with stable ids) in SCOP 1.55, called d1noa__
  
• d1noaa_ appears in SCOPe 2.07