![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) ![]() automatically mapped to Pfam PF00960 |
![]() | Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
![]() | Protein Neocarzinostatin [49323] (1 species) |
![]() | Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries) |
![]() | Domain d1noaa_: 1noa A: [22208] |
PDB Entry: 1noa (more details), 1.5 Å
SCOPe Domain Sequences for d1noaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1noaa_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]} aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn
Timeline for d1noaa_: