SCOPe 2.07: Domain d4gpha_: 4gph A:

Lineage for d4gpha_ (4gph A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d4gpha_: 4gph A: [222079]
   automated match to d1iw1a_
   complexed with asc, bla, fe, so4

Details for d4gpha_

PDB Entry: 4gph, 1.7 Å

PDB Description: structure of hmuo, heme oxygenase from corynebacterium diphtheriae, in complex with the putative reaction intermediates between fe3+- biliverdin and biliverdin (data set iv)

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d4gpha_:

Sequence; same for both SEQRES and ATOM records:

>d4gpha_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
taglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavr
asgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpa
lvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnle
lsdeqrehllkeatdafvfnhqvfadlgk

Timeline for d4gpha_:

• d4gpha_ first appeared in SCOPe 2.03
  
• d4gpha_ appears in SCOPe 2.06
  
• d4gpha_ appears in the current release, SCOPe 2.08