SCOPe 2.07: Domain d4gpfc_: 4gpf C:

Lineage for d4gpfc_ (4gpf C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d4gpfc_: 4gpf C: [222078]
   automated match to d1iw1a_
   complexed with bla, fe, so4

Details for d4gpfc_

PDB Entry: 4gpf, 1.9 Å

PDB Description: Structure of the Fe3+-biliverdin-HmuO, heme oxygenase from Corynebacterium diphtheriae (data set III)

PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d4gpfc_:

Sequence; same for both SEQRES and ATOM records:

>d4gpfc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
sdeqrehllkeatdafvfnhqvfadlgk

Timeline for d4gpfc_:

• d4gpfc_ first appeared in SCOPe 2.03
  
• d4gpfc_ appears in SCOPe 2.06
  
• d4gpfc_ appears in the current release, SCOPe 2.08