SCOPe 2.06: Domain d4gpfa_: 4gpf A:

Lineage for d4gpfa_ (4gpf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d4gpfa_: 4gpf A: [222076]
   automated match to d1iw0a_
   complexed with bla, fe, so4

Details for d4gpfa_

PDB Entry: 4gpf, 1.9 Å

PDB Description: Structure of the Fe3+-biliverdin-HmuO, heme oxygenase from Corynebacterium diphtheriae (data set III)

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d4gpfa_:

Sequence; same for both SEQRES and ATOM records:

>d4gpfa_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d4gpfa_:

• d4gpfa_ first appeared in SCOPe 2.03
  
• d4gpfa_ appears in SCOPe 2.05
  
• d4gpfa_ appears in SCOPe 2.07
  
• d4gpfa_ appears in the current release, SCOPe 2.08