SCOPe 2.07: Domain d4gp4a_: 4gp4 A:

Lineage for d4gp4a_ (4gp4 A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)

8. Domain d4gp4a_: 4gp4 A: [222061]
   Other proteins in same PDB: d4gp4b1, d4gp4b2, d4gp4c_
   automated match to d2qpea_
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d4gp4a_

PDB Entry: 4gp4, 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133F from Thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d4gp4a_:

Sequence; same for both SEQRES and ATOM records:

>d4gp4a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
atvlftfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

Timeline for d4gp4a_:

• d4gp4a_ first appeared in SCOPe 2.03
  
• d4gp4a_ appears in SCOPe 2.06
  
• d4gp4a_ appears in the current release, SCOPe 2.08