| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (3 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Mouse (Mus musculus) [TaxId:10090] [49318] (13 PDB entries) |
| Domain d1suha_: 1suh A: [22206] domain 1 |
PDB Entry: 1suh (more details)
SCOPe Domain Sequences for d1suha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suha_ b.1.6.1 (A:) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndn
Timeline for d1suha_: