Lineage for d4goka_ (4gok A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866747Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (6 PDB entries)
  8. 2866752Domain d4goka_: 4gok A: [222059]
    automated match to d2rhda_
    complexed with gnp, mg

Details for d4goka_

PDB Entry: 4gok (more details), 2.6 Å

PDB Description: The Crystal structure of Arl2GppNHp in complex with UNC119a
PDB Compounds: (A:) ADP-ribosylation factor-like protein 2

SCOPe Domain Sequences for d4goka_:

Sequence, based on SEQRES records: (download)

>d4goka_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvgglkslrsy
wrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscn
aiqealeldsirshhwriqgcsavtgedllpgidwllddissr

Sequence, based on observed residues (ATOM records): (download)

>d4goka_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkfntisptlgfniktlehrgfklniwdvgglkslrsywrnyf
estdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscnaiqea
leldsirshhwriqgcsavtgedllpgidwllddissr

SCOPe Domain Coordinates for d4goka_:

Click to download the PDB-style file with coordinates for d4goka_.
(The format of our PDB-style files is described here.)

Timeline for d4goka_: