Lineage for d4go9b1 (4go9 B:4-478)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1569091Protein automated matches [190099] (19 species)
    not a true protein
  7. 1569169Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries)
  8. 1569185Domain d4go9b1: 4go9 B:4-478 [222054]
    Other proteins in same PDB: d4go9a2, d4go9b2
    automated match to d1m53a2
    complexed with ca, trs; mutant

Details for d4go9b1

PDB Entry: 4go9 (more details), 2.2 Å

PDB Description: crystal structure of the trehalulose synthase mutant, mutb d415n, in complex with tris
PDB Compounds: (B:) Sucrose isomerase

SCOPe Domain Sequences for d4go9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4go9b1 c.1.8.1 (B:4-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
apwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdng
ydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnpy
rdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreely
amlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhekv
fdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladfr
qtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpfi
fqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrnnartpfqw
ddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst

SCOPe Domain Coordinates for d4go9b1:

Click to download the PDB-style file with coordinates for d4go9b1.
(The format of our PDB-style files is described here.)

Timeline for d4go9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4go9b2