Lineage for d4go9a2 (4go9 A:479-557)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. 1556313Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)
  8. 1556328Domain d4go9a2: 4go9 A:479-557 [222053]
    Other proteins in same PDB: d4go9a1, d4go9b1
    automated match to d1m53a1
    complexed with ca, trs; mutant

Details for d4go9a2

PDB Entry: 4go9 (more details), 2.2 Å

PDB Description: crystal structure of the trehalulose synthase mutant, mutb d415n, in complex with tris
PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4go9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4go9a2 b.71.1.0 (A:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykvk

SCOPe Domain Coordinates for d4go9a2:

Click to download the PDB-style file with coordinates for d4go9a2.
(The format of our PDB-style files is described here.)

Timeline for d4go9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4go9a1