![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein automated matches [190099] (14 species) not a true protein |
![]() | Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries) |
![]() | Domain d4go8b1: 4go8 B:2-478 [222050] Other proteins in same PDB: d4go8a2, d4go8b2 automated match to d1m53a2 complexed with ca, trs; mutant |
PDB Entry: 4go8 (more details), 2.15 Å
SCOPe Domain Sequences for d4go8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4go8b1 c.1.8.1 (B:2-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]} pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe kvfdhydavtageifgvplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst
Timeline for d4go8b1: