Lineage for d1ff5b2 (1ff5 B:102-218)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10068Superfamily b.1.6: Cadherin [49313] (1 family) (S)
  5. 10069Family b.1.6.1: Cadherin [49314] (2 proteins)
  6. 10070Protein E-cadherin (epithelial) [49317] (1 species)
  7. 10071Species Mouse (Mus musculus) [TaxId:10090] [49318] (3 PDB entries)
  8. 10079Domain d1ff5b2: 1ff5 B:102-218 [22205]

Details for d1ff5b2

PDB Entry: 1ff5 (more details), 2.93 Å

PDB Description: structure of e-cadherin double domain

SCOP Domain Sequences for d1ff5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff5b2 b.1.6.1 (B:102-218) E-cadherin (epithelial) {Mouse (Mus musculus)}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkdindna

SCOP Domain Coordinates for d1ff5b2:

Click to download the PDB-style file with coordinates for d1ff5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ff5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff5b1