SCOPe 2.08: Domain d1ff5b2: 1ff5 B:102-218

Lineage for d1ff5b2 (1ff5 B:102-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d1ff5b2: 1ff5 B:102-218 [22205]
   two-domain fragment
   complexed with ca

Details for d1ff5b2

PDB Entry: 1ff5, 2.93 Å

PDB Description: structure of e-cadherin double domain

PDB Compounds: (B:) epithelial cadherin

SCOPe Domain Sequences for d1ff5b2:

Sequence; same for both SEQRES and ATOM records:

>d1ff5b2 b.1.6.1 (B:102-218) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkdindna

Timeline for d1ff5b2:

• d1ff5b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ff5b2 appears in SCOPe 2.07