SCOPe 2.08: Domain d4go8a2: 4go8 A:479-556

Lineage for d4go8a2 (4go8 A:479-556)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)

8. Domain d4go8a2: 4go8 A:479-556 [222049]
   Other proteins in same PDB: d4go8a1, d4go8b1
   automated match to d1m53a1
   complexed with ca, trs; mutant

Details for d4go8a2

PDB Entry: 4go8, 2.15 Å

PDB Description: crystal structure of the trehalulose synthase mutb, mutant a258v, in complex with tris

PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4go8a2:

Sequence; same for both SEQRES and ATOM records:

>d4go8a2 b.71.1.0 (A:479-556) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykv

Timeline for d4go8a2:

• d4go8a2 first appeared in SCOPe 2.03
  
• d4go8a2 appears in SCOPe 2.07