| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
| Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) |
| Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (25 PDB entries) |
| Domain d4gnoa1: 4gno A:2-259 [222040] Other proteins in same PDB: d4gnoa2 automated match to d1khba2 complexed with 1pe, gtp, mn, na, spv |
PDB Entry: 4gno (more details), 1.5 Å
SCOPe Domain Sequences for d4gnoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gnoa1 c.109.1.1 (A:2-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmq
eegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseed
fekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvl
ealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsll
gkkcfalriasrlakeeg
Timeline for d4gnoa1: