Lineage for d1ff5b1 (1ff5 B:-1-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763446Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2763488Domain d1ff5b1: 1ff5 B:-1-101 [22204]
    two-domain fragment
    complexed with ca

Details for d1ff5b1

PDB Entry: 1ff5 (more details), 2.93 Å

PDB Description: structure of e-cadherin double domain
PDB Compounds: (B:) epithelial cadherin

SCOPe Domain Sequences for d1ff5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff5b1 b.1.6.1 (B:-1-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
mdwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgw
lkvtqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d1ff5b1:

Click to download the PDB-style file with coordinates for d1ff5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ff5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff5b2