Lineage for d4gnma1 (4gnm A:4-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149704Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2149705Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2149715Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (40 PDB entries)
  8. 2149727Domain d4gnma1: 4gnm A:4-259 [222038]
    Other proteins in same PDB: d4gnma2
    automated match to d1khba2
    complexed with gtp, mn, na, oxl

Details for d4gnma1

PDB Entry: 4gnm (more details), 1.5 Å

PDB Description: structure of rat cytosolic pepck ld_2g in complex with oxalate and gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4gnma1:

Sequence, based on SEQRES records: (download)

>d4gnma1 c.109.1.1 (A:4-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqee
gvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfe
kafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlea
lgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgk
kcfalriasrlakeeg

Sequence, based on observed residues (ATOM records): (download)

>d4gnma1 c.109.1.1 (A:4-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qlhldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegv
irklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfeka
fnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealg
dgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkc
falriasrlakeeg

SCOPe Domain Coordinates for d4gnma1:

Click to download the PDB-style file with coordinates for d4gnma1.
(The format of our PDB-style files is described here.)

Timeline for d4gnma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gnma2