SCOPe 2.06: Domain d4gnib1: 4gni B:12-195

Lineage for d4gnib1 (4gni B:12-195)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:759272] [226535] (1 PDB entry)

8. Domain d4gnib1: 4gni B:12-195 [222034]
   automated match to d1dkgd1
   complexed with atp, mg

Details for d4gnib1

PDB Entry: 4gni, 1.8 Å

PDB Description: Structure of the Ssz1 ATPase bound to ATP and Magnesium

PDB Compounds: (B:) Putative heat shock protein

SCOPe Domain Sequences for d4gnib1:

Sequence; same for both SEQRES and ATOM records:

>d4gnib1 c.55.1.0 (B:12-195) automated matches {Chaetomium thermophilum [TaxId: 759272]}
ervvigitfgnsnssiahtvddkaevianedgdrqiptilsyvdgdeyygqqaknflvrn
pkntvayfrdilgqdfksvdpthnhasahpqeagdnvvftikdkaeedaepstltvseia
trylrrlvgaaseylgkkvtsavitiptnftekqkaaliaaaaaadlevlqlisepaaav
layd

Timeline for d4gnib1:

• d4gnib1 first appeared in SCOPe 2.03
  
• d4gnib1 appears in SCOPe 2.05
  
• d4gnib1 appears in SCOPe 2.07
  
• d4gnib1 appears in the current release, SCOPe 2.08