SCOPe 2.05: Domain d1ff5a2: 1ff5 A:102-218

Lineage for d1ff5a2 (1ff5 A:102-218)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d1ff5a2: 1ff5 A:102-218 [22203]
   two-domain fragment
   complexed with ca

Details for d1ff5a2

PDB Entry: 1ff5, 2.93 Å

PDB Description: structure of e-cadherin double domain

PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d1ff5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ff5a2 b.1.6.1 (A:102-218) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkdindna

Timeline for d1ff5a2:

• d1ff5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ff5a2 appears in SCOPe 2.04
  
• d1ff5a2 appears in SCOPe 2.06
  
• d1ff5a2 appears in the current release, SCOPe 2.08